Crude venom is characterized by six methods in an independent laboratory. The values on this page refer to the reference batch; every shipment is sent with its own batch analysis report.
Analysis is carried out in an independent laboratory, not in our own facility
Keeping production and measurement in separate hands strengthens the impartiality of the results. The sample is delivered to the laboratory under its batch number; the report is issued based on the laboratory's own method and instrument records.
For the reference batch, the sample was delivered on 30.06.2026 and the analysis report was issued on 04.07.2026. We have also explained why independent analysis matters.
Five-stage characterization
Sample receipt and species record
The sample is received under its batch number; the source species and form are recorded.
Protein concentration and pH
The amount of protein is measured against a standard curve, together with the acidity of the crude venom.
UV-Vis spectrum analysis
A scan from 190 to 400 nm is performed; the protein-specific peak at 280 nm is confirmed.
RP-HPLC fractionation
Components are separated by reversed-phase chromatography; peaks are recorded at 280 nm.
SDS-PAGE and peptide identification
The molecular weight distribution is determined and the target peptide is identified at the sequence level.
Reference batch findings
SDS-PAGE37 kDa band
- Standard range
- 10–250 kDa
- Intense band
- ~37 kDa
- Protein range
- 10–25 kDa
- Loading series
- 5–30 µg
UV-Vis280 nm
- Scan range
- 190–400 nm
- Specific peak
- 280 nm
- Spectrophotometer
- Shimadzu UV-1900i
The graphs are representative profiles drawn from the values in the report and are not to scale. The measurement outputs are included in the batch analysis report.
Chromatographic conditions
| Parameter | Value |
|---|---|
| Instrument | Shimadzu Prominence-i LC2030 3D |
| Method | Reversed phase (RP-HPLC) |
| Sample concentration | 1000 ppm |
| Gradient | Solvent B · 0–60% shallow gradient |
| Detection | 280 nm |
| Resolved fractions | 37 |
Identified target peptide
α-KTx family · Kv channel blocker
α-KTx 3.6
- rKv1.1
- rKv1.2
- hKv1.3
Amino acid sequence (cysteines highlighted)
FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
- Length
- 36 amino acids
- Cysteine
- 6
- Class
- α-KTx
For how to read the sequence, see the guide to one-letter amino acid codes; for the peptide family, see the article on α-KTx.
Analyses performed
| Analysis | Purpose | Output |
|---|---|---|
| UV-visible spectrophotometry | Determining the wavelength of maximum absorbance | Specific peak at 280 nm |
| pH analysis | Acidity of the crude venom | pH 5.72 |
| Protein concentration | Quantification against a standard curve | 28 mg/mL |
| SDS-PAGE | Molecular weight distribution | 10–25 kDa + 37 kDa band |
| RP-HPLC | Component separation and fractionation | 37 proteins / peptides |
| Peptide analysis | Sequence-level identification of the target peptide | α-KTx 3.6 · Kv1.1 / Kv1.2 / Kv1.3 |
Data integrity. The values on this page are taken from the independent laboratory's reference batch report and may vary from batch to batch. Purchasing decisions should be based on the batch report of the shipment; the report is also shared before ordering on request.
Frequently asked questions
The analyses are carried out in an independent laboratory, not at the production facility. For the reference batch, the sample was delivered on 30.06.2026 and the analysis report was issued on 04.07.2026.
RP-HPLC with detection at 280 nm resolved 37 protein and peptide fractions. The protein concentration was measured at 28 mg/mL and the pH at 5.72.
α-KTx 3.6 is a 36-amino-acid peptide containing 6 cysteines that blocks voltage-gated potassium (Kv) channels. Its reported target channels are rKv1.1, rKv1.2 and hKv1.3.
You can submit your request by selecting the "Batch analysis report" subject in the request form on the Contact page. The report is also shared with institutional buyers before ordering.
Request a batch analysis report
Send us your request for the reference batch report or the batch report of your shipment.
