Hatay · Dörtyol · Türkiye
Androctonus turkiyensis crude venom, produced in a facility holding an establishment permit from the Ministry of Agriculture and Forestry and analysed batch by batch in an independent laboratory.
37
Protein & Peptide
Closed-Cycle Breeding
In our licensed facility, every individual is monitored in its own container; the colony is registered, inspected and supervised by the General Directorate of Nature Conservation and National Parks.
180m²
Licensed Facility Area
Sterile Extraction
Venom is collected from each individual separately under sterile conditions and prepared as lyophilized powder and in liquid form; every batch is tracked with its own record.
%100
Sample Purity
Stabilization & Cold Chain
Samples are freeze-dried and kept in a deep freezer; every batch is characterized in an independent laboratory.
6
Analytical Method
Androctonus turkiyensis Crude Scorpion Venom Lyophilized Powder Liquid Form RP-HPLC SDS-PAGE UV-Vis Not CITES-Listed Ministry Establishment PermitSource Species · GBP 1000352242
Our venom is obtained from Türkiye's own scorpion species, Androctonus turkiyensis. The colony originates from Şanlıurfa; the species is verified by morphological identification and every batch is tracked on record.
Described by
Buthidae · Şanlıurfa
Production Chain
From species verification in the colony to the shipping file, every step is carried out in a single facility and fully documented. Crude venom is supplied B2B to institutions for research and industrial use.
Every individual is monitored in its own container; registration and inspection by the DKMP General Directorate.
DetailsVenom is collected from each individual separately under sterile conditions; powder and liquid forms are prepared.
DetailsFreeze-dried samples are stored in a deep freezer, within the cold chain.
DetailsEvery batch is characterized in an independent laboratory by RP-HPLC, SDS-PAGE and UV-Vis.
Details
Regulatory Compliance
Every stage of our operation, from the establishment permit to the CITES assessment, is documented in official correspondence. Copies of the documents are shared with institutions and buyers on request.
Ministry of Agriculture and Forestry
DKMP General Directorate
Value Chain
Six steps from species verification to the export file. The output of each step is the input of the next and is recorded; the buyer sees every stage the venom passes through, backed by documents.
Packing group I; shipment in compliance with ADR, IMDG and IATA rules.
Individuals are monitored in separate containers; the species is verified by morphological identification and recorded.
Venom is collected from each individual separately under sterile conditions; every extraction is entered in the batch record.
Freeze-dried; stored in the cold chain as powder or in liquid form.
Every batch is characterized in an independent laboratory by UV-Vis, SDS-PAGE and RP-HPLC.
An SDS compliant with REACH and KKDİK is prepared; the packaging is labelled with the GHS06 pictogram.
Each shipment is dispatched as a single file together with the analysis report and copies of the permits.
Analytical Identity
The RP-HPLC profile of the reference batch shows 37 protein and peptide fractions at 280 nm. Among them, α-KTx 3.6 is a peptide defined at the sequence level that blocks voltage-gated potassium (Kv) channels.
Target peptide
Amino acid sequence (cysteines highlighted)
FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
Images from the Facility
Androctonus turkiyensis individuals are kept in separate containers under controlled conditions; feeding and access to water are monitored regularly. The footage was recorded at our facility.
Frequently Asked Questions
The questions our buyers ask most often about the species, product forms, CITES status and shipping documents. If you cannot find the answer you are looking for, write to us.
Scorpion venom is a mixture of proteins and peptides obtained from the venom glands of scorpions. The crude venom we supply is intended solely for research and industrial use, such as pharmaceutical R&D, ion channel studies and analytical reference material. It is not intended for direct use on humans or animals.
Androctonus turkiyensis is Türkiye's own black scorpion species of the family Buthidae, described by Yağmur (2021). Our colony originates from Şanlıurfa; the species is verified by morphological identification and tracked under registration number GBP 1000352242.
No. According to the assessment of the General Directorate of Nature Conservation and National Parks dated 30.07.2026, Androctonus turkiyensis is not included in CITES Appendices I, II or III. Shipments follow the UN 3462, Class 6.1 transport rules; the import regulations of the destination country are checked separately.
Lyophilized venom is a freeze-dried, white, soluble powder; it is more stable for storage and transport. The liquid form is clear and soluble, with a pH of 3.5. Both forms are stored in the cold chain, and every batch is shipped with its own analysis report.
Every shipment is accompanied by the safety data sheet (SDS / MSDS), the batch analysis report, copies of the establishment permit and business licence, and the shipping and customs file. Copies of the documents can also be requested before ordering.
You can submit a request via the form on the Contact page, stating the product form (powder or liquid), the quantity and the intended use. Institutional buyers receive a quote together with specifications, the analysis report and copies of the documents.
Blog
